PDB entry 3hmh

View 3hmh on RCSB PDB site
Description: Crystal structure of the second bromodomain of human TBP-associated factor RNA polymerase 1-like (TAF1L)
Class: transcription
Keywords: MGC134910, TAF2A2, Structural Genomics Consortium, SGC, Bromodomain, Cell cycle, Disulfide bond, DNA-binding, Nucleus, Transcription, Transcription regulation
Deposited on 2009-05-29, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID 210 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IZX4 (23-End)
      • expression tag (13-22)
    Domains in SCOPe 2.07: d3hmha1, d3hmha2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hmhA (A:)
    mhhhhhhssgvdlgtenlyfqsmqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdy
    ykmivnpvdletirkniskhkyqsresflddvnlilansvkyngpesqytktaqeivnic
    yqtiteydehltqlekdictakeaaleeaelesld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hmhA (A:)
    gtenlyfqsmqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykmivnpvdleti
    rkniskhkyqsresflddvnlilansvkyngpesqytktaqeivnicyqtiteydehltq
    lekdictakeaaleeaele