PDB entry 3hlw

View 3hlw on RCSB PDB site
Description: CTX-M-9 S70G in complex with cefotaxime
Class: Hydrolase
Keywords: beta-lactamase, ESBL, CTX-M, CTX-M-9, beta-lactam, cephalosporin, cefotaxime, michaelis, complex, Antibiotic resistance, Hydrolase
Deposited on 2009-05-28, released 2010-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTX-M-9 extended-spectrum beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-9, blaCTX-M-9a, blaCTX-M-9b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C8 (0-262)
      • engineered (44)
    Domains in SCOPe 2.06: d3hlwa_
  • Chain 'B':
    Compound: CTX-M-9 extended-spectrum beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-9, blaCTX-M-9a, blaCTX-M-9b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C8 (Start-262)
      • engineered (44)
    Domains in SCOPe 2.06: d3hlwb_
  • Heterogens: CE3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hlwA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hlwB (B:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hlwB (B:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqset
    qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaegl