PDB entry 3hlv

View 3hlv on RCSB PDB site
Description: Crystal structure of human Estrogen Receptor Alpha Ligand-Binding Domain in complex with a Glucocorticoid Receptor Interacting Protein 1 Nr Box II Peptide and 16-alpha-hydroxy-estrone ((8S,9R,13S,14R,16R)-3,16-dihydroxy-13-methyl-7,8,9,11,12,14,15, 16-octahydro-6H-cyclopenta[a]phenanthren-17-one
Class: transcription
Keywords: estrogen receptor, LBD, GRIP peptide, hydroxy-estrone, Alternative splicing, DNA-binding, Glycoprotein, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc, Zinc-finger, Activator, HORMONE, NUCLEAR RECEPTOR
Deposited on 2009-05-28, released 2010-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR, ESR1, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (239)
    Domains in SCOPe 2.06: d3hlva_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR, ESR1, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (239)
    Domains in SCOPe 2.06: d3hlvb_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: J2Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hlvA (A:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hlvA (A:)
    nslalsltadqmvsalldaeppilyseydpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytfltlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hlvB (B:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hlvB (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.