PDB entry 3hkw

View 3hkw on RCSB PDB site
Description: HCV NS5B genotype 1a in complex with 1,5 benzodiazepine inhibitor 6
Class: transferase
Keywords: HCV POLYMERASE, subtype 1a, 1, 5-Benzodiazepine, TRANSFERASE
Deposited on 2009-05-26, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS5B RNA-dependent RNA polymerase
    Species: Hepatitis C virus subtype 1a [TaxId:31646]
    Gene: HCV INFECTED PATIENT
    Database cross-references and differences (RAF-indexed):
    • PDB 3HKW
    Domains in SCOPe 2.07: d3hkwa_
  • Chain 'B':
    Compound: NS5B RNA-dependent RNA polymerase
    Species: Hepatitis C virus subtype 1a [TaxId:31646]
    Gene: HCV INFECTED PATIENT
    Database cross-references and differences (RAF-indexed):
    • PDB 3HKW
    Domains in SCOPe 2.07: d3hkwb_
  • Chain 'C':
    Compound: NS5B RNA-dependent RNA polymerase
    Species: Hepatitis C virus subtype 1a [TaxId:31646]
    Gene: HCV INFECTED PATIENT
    Database cross-references and differences (RAF-indexed):
    • PDB 3HKW
    Domains in SCOPe 2.07: d3hkwc_
  • Heterogens: IX6, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hkwA (A:)
    massmsyswtgalvtpcaaeeqklpinalsnsllrhhnmvysttsrsacqrqkkvtfdrl
    qvldshyqdvlkevkaaaskvkanllsveeacsltpphsarskfgygakdvrcharkavt
    hinsvwkdlledsvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalyd
    vvsklpqavmgssygfqyspgqrveflvqawkskkspmgfsydtrcfdstvtesdirtee
    aiyqccdldpqarvaikslterlyvggpltnskgencgyrrcrasgvlttscgntltcyi
    karaacraaglqdctmlvcgddlvvicesagvqedaaslrafteamtrysappgdppqpe
    ydlelitscssnvsvahdgagkrvyyltrdpttplaraawetarhtpvnswlgniimfap
    tlwarmilmthffsvliardqleqaldceiygacysiepldlppiiqrlhglsafslhsy
    spgeinrvaaclrklgvpplrawrhrarsvrakllsrggraaicgkylfnwavrtklklt
    piaaagqldlsgwftagysggdiyhsvsrarprlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hkwA (A:)
    smsyswtgalvtpcaaeeqklpinalsnsllrhhnmvysttsrsacqrqkkvtfdrlqvl
    dshyqdvlkevkaaaskvkanllsveeacsltpphsarskfgygakdvrcharkavthin
    svwkdlledsvtpidttimaknevfcvqpggrkparlivfpdlgvrvcekmalydvvskl
    pqavmgssygfqyspgqrveflvqawkskkspmgfsydtrcfdstvtesdirteeaiyqc
    cdldpqarvaikslterlyvggpltnskgencgyrrcrasgvlttscgntltcyikaraa
    craaglqdctmlvcgddlvvicesagvqedaaslrafteamtrysappgdppqpeydlel
    itscssnvsvahdgagkrvyyltrdpttplaraawetarhtpvnswlgniimfaptlwar
    milmthffsvliardqleqaldceiygacysiepldlppiiqrlhglsafslhsyspgei
    nrvaaclrklgvpplrawrhrarsvrakllsrggraaicgkylfnwavrtklkltpiaaa
    gqldlsgwftagysggdiyhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hkwB (B:)
    massmsyswtgalvtpcaaeeqklpinalsnsllrhhnmvysttsrsacqrqkkvtfdrl
    qvldshyqdvlkevkaaaskvkanllsveeacsltpphsarskfgygakdvrcharkavt
    hinsvwkdlledsvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalyd
    vvsklpqavmgssygfqyspgqrveflvqawkskkspmgfsydtrcfdstvtesdirtee
    aiyqccdldpqarvaikslterlyvggpltnskgencgyrrcrasgvlttscgntltcyi
    karaacraaglqdctmlvcgddlvvicesagvqedaaslrafteamtrysappgdppqpe
    ydlelitscssnvsvahdgagkrvyyltrdpttplaraawetarhtpvnswlgniimfap
    tlwarmilmthffsvliardqleqaldceiygacysiepldlppiiqrlhglsafslhsy
    spgeinrvaaclrklgvpplrawrhrarsvrakllsrggraaicgkylfnwavrtklklt
    piaaagqldlsgwftagysggdiyhsvsrarprlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hkwB (B:)
    smsyswtgalvtpcaaeeqklpinalsnsllrhhnmvysttsrsacqrqkkvtfdrlqvl
    dshyqdvlkevkaaaskvkanllsveeacsltpphsarskfgygakdvrcharkavthin
    svwkdlledsvtpidttimaknevfcvqpgrkparlivfpdlgvrvcekmalydvvsklp
    qavmgssygfqyspgqrveflvqawkskkspmgfsydtrcfdstvtesdirteeaiyqcc
    dldpqarvaikslterlyvggpltnskgencgyrrcrasgvlttscgntltcyikaraac
    raaglqdctmlvcgddlvvicesagvqedaaslrafteamtrysappgdppqpeydleli
    tscssnvsvahdgagkrvyyltrdpttplaraawetarhtpvnswlgniimfaptlwarm
    ilmthffsvliardqleqaldceiygacysiepldlppiiqrlhglsafslhsyspgein
    rvaaclrklgvpplrawrhrarsvrakllsrggraaicgkylfnwavrtklkltpiaaag
    qldlsgwftagysggdiyhs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hkwC (C:)
    massmsyswtgalvtpcaaeeqklpinalsnsllrhhnmvysttsrsacqrqkkvtfdrl
    qvldshyqdvlkevkaaaskvkanllsveeacsltpphsarskfgygakdvrcharkavt
    hinsvwkdlledsvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalyd
    vvsklpqavmgssygfqyspgqrveflvqawkskkspmgfsydtrcfdstvtesdirtee
    aiyqccdldpqarvaikslterlyvggpltnskgencgyrrcrasgvlttscgntltcyi
    karaacraaglqdctmlvcgddlvvicesagvqedaaslrafteamtrysappgdppqpe
    ydlelitscssnvsvahdgagkrvyyltrdpttplaraawetarhtpvnswlgniimfap
    tlwarmilmthffsvliardqleqaldceiygacysiepldlppiiqrlhglsafslhsy
    spgeinrvaaclrklgvpplrawrhrarsvrakllsrggraaicgkylfnwavrtklklt
    piaaagqldlsgwftagysggdiyhsvsrarprlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hkwC (C:)
    smsyswtgalvtpcaaeeqklpinalsnsllrhhnmvysttsrsacqrqkkvtfdrlqvl
    dshyqdvlkevkaaaskvkanllsveeacsltpphsarskfgygakdvrcharkavthin
    svwkdlledsvtpidttimaknevfcvqggrkparlivfpdlgvrvcekmalydvvsklp
    qavmgssygfqyspgqrveflvqawkskkspmgfsydtrcfdstvtesdirteeaiyqcc
    dldpqarvaikslterlyvggpltnskgencgyrrcrasgvlttscgntltcyikaraac
    raaglqdctmlvcgddlvvicesagvqedaaslrafteamtrysappgdppqpeydleli
    tscssnvsvahdgagkrvyyltrdpttplaraawetarhtpvnswlgniimfaptlwarm
    ilmthffsvliardqleqaldceiygacysiepldlppiiqrlhglsafslhsyspgein
    rvaaclrklgvpplrawrhrarsvrakllsrggraaicgkylfnwavrtklkltpiaaag
    qldlsgwftagysggdiyhs