PDB entry 3hju

View 3hju on RCSB PDB site
Description: Crystal structure of human monoglyceride lipase
Class: hydrolase
Keywords: alpha/beta hydrolase, Hydrolase, Serine esterase
Deposited on 2009-05-22, released 2009-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoglyceride lipase
    Species: Homo sapiens [TaxId:9606]
    Gene: MGLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hjua_
  • Chain 'B':
    Compound: Monoglyceride lipase
    Species: Homo sapiens [TaxId:9606]
    Gene: MGLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hjub_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hjuA (A:)
    mrgshhhhhhgagdrgpefpeessprrtpqsipyqdlphlvnadgqylfcrywkptgtpk
    alifvshgagehsgryeelarmlmgldllvfahdhvghgqsegermvvsdfhvfvrdvlq
    hvdsmqkdypglpvfllghsmggaiailtaaerpghfagmvlisplvlanpesattfkvl
    aakvlnlvlpnlslgpidssvlsrnktevdiynsdplicraglkvcfgiqllnavsrver
    alpkltvpflllqgsadrlcdskgayllmelaksqdktlkiyegayhvlhkelpevtnsv
    fheinmwvsqrtatagtaspplevdlqgdhglsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hjuA (A:)
    prrtpqsipyqdlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarmlm
    gldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgga
    iailtaaerpghfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvlsr
    nktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskg
    ayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrtata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hjuB (B:)
    mrgshhhhhhgagdrgpefpeessprrtpqsipyqdlphlvnadgqylfcrywkptgtpk
    alifvshgagehsgryeelarmlmgldllvfahdhvghgqsegermvvsdfhvfvrdvlq
    hvdsmqkdypglpvfllghsmggaiailtaaerpghfagmvlisplvlanpesattfkvl
    aakvlnlvlpnlslgpidssvlsrnktevdiynsdplicraglkvcfgiqllnavsrver
    alpkltvpflllqgsadrlcdskgayllmelaksqdktlkiyegayhvlhkelpevtnsv
    fheinmwvsqrtatagtaspplevdlqgdhglsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hjuB (B:)
    sprrtpqsipyqdlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarml
    mgldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgg
    aiailtaaerpghfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvls
    rnktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdsk
    gayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrtat