PDB entry 3hjt

View 3hjt on RCSB PDB site
Description: Structure of laminin binding protein (Lmb) of Streptococcus agalactiae A bifunctional protein with adhesin and metal transporting activity
Class: cell adhesion, transport protein
Keywords: adhesin, metal transporter, surface protein, laminin binding, ATP binding cassette, SBPs (Solute Binding Proteins), Transport, TRANSPORT PROTEIN, CELL ADHESION
Deposited on 2009-05-22, released 2009-12-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.234
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lmb
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Gene: lmb
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Lmb
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Gene: lmb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3hjtb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hjtB (B:)
    cdksanpkqptqgmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiy
    dadlfvyhshtleawardldpnlkkskvnvfeaskpltldrvkgledmevtqgidpatly
    dphtwtdpvlageeavniakelghldpkhkdsytkkakafkkeaeqlteeytqkfkkvrs
    ktfvtqhtafsylakrfglkqlgisgispeqepsprqlkeiqdfvkeynvktifaednvn
    pkiahaiakstgakvktlspleaapsgnktylenlranlevlyqqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hjtB (B:)
    gmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiydadlfvyhshtl
    eawardldpkskvnvfeaskpltldrvklydphtwtdpvlageeavniakelghldpkhk
    dsytkkakafkkeaeqlteeytqkfkkvrsktfvtqhtafsylakrfglkqlgisgispe
    qepsprqlkeiqdfvkeynvktifaednvnpkiahaiakstgakvktlspleaapsgnkt
    ylenlranlevlyqqlk