PDB entry 3hi9

View 3hi9 on RCSB PDB site
Description: The x-ray crystal structure of the first RNA recognition motif (RRM1) of the AU-rich element (ARE) binding protein HuR at 2.0 angstrom resolution
Class: transcription
Keywords: beta1-alpha1-beta2-beta3-alpha2-beta4 topology, Methylation, Phosphoprotein, RNA-binding, TRANSCRIPTION
Deposited on 2009-05-19, released 2010-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ELAVL1, HUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hi9a_
  • Chain 'B':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ELAVL1, HUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hi9b_
  • Chain 'C':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ELAVL1, HUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hi9c_
  • Chain 'D':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ELAVL1, HUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hi9d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hi9A (A:)
    gpgrtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdae
    raintlnglrlqsktikvsyarps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi9A (A:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hi9B (B:)
    gpgrtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdae
    raintlnglrlqsktikvsyarps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi9B (B:)
    grtnlivnylpqnmtqdelrslfssigevesaklirslgygfvnyvtakdaeraintlng
    lrlqsktikvsyarp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hi9C (C:)
    gpgrtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdae
    raintlnglrlqsktikvsyarps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi9C (C:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hi9D (D:)
    gpgrtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdae
    raintlnglrlqsktikvsyarps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi9D (D:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsyarps