PDB entry 3hi5

View 3hi5 on RCSB PDB site
Description: Crystal structure of Fab fragment of AL-57
Class: immune system
Keywords: Fab fragment, ligand mimetic, integrin, I domain, cell adhesion, IMMUNE SYSTEM
Deposited on 2009-05-18, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of Fab fragment of AL-57 against alpha L I domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI5 (Start-219)
  • Chain 'L':
    Compound: light chain of Fab fragment of AL-57 against alpha L I domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI5 (Start-211)
    Domains in SCOPe 2.07: d3hi5l1, d3hi5l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3hi5L (L:)
    qdiqmtqspsslsasvgdrvtitcrasqsigsylnwyqqktgkapkaliyaasslqsgvp
    srfsgsgsgtdftltisslqledfatyycqqsystpsfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi5L (L:)
    diqmtqspsslsasvgdrvtitcrasqsigsylnwyqqktgkapkaliyaasslqsgvps
    rfsgsgsgtdftltisslqledfatyycqqsystpsfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg