PDB entry 3hhq

View 3hhq on RCSB PDB site
Description: Crystal structure of apo dUT1p from Saccharomyces cerevisiae
Class: hydrolase
Keywords: trimer, beta barrel, apo structure, dUTP pyrophosphatase, Saccharomyces cerevisiae, molecular replacement, Hydrolase, Nucleotide metabolism, Phosphoprotein
Deposited on 2009-05-15, released 2009-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqa_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqb_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqc_
  • Chain 'D':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqd_
  • Chain 'E':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqe_
  • Chain 'F':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqf_
  • Chain 'G':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqg_
  • Chain 'H':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqh_
  • Chain 'I':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqi_
  • Chain 'J':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqj_
  • Chain 'K':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqk_
  • Chain 'L':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhql_
  • Chain 'M':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqm_
  • Chain 'N':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqn_
  • Chain 'O':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqo_
  • Chain 'P':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqp_
  • Chain 'Q':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqq_
  • Chain 'R':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqr_
  • Chain 'S':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqs_
  • Chain 'T':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqt_
  • Chain 'U':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqu_
  • Chain 'V':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqv_
  • Chain 'W':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqw_
  • Chain 'X':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, dUT1p, YBR1705, YBR252W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hhqx_
  • Heterogens: SO4, NA, CL, EDO, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hhqA (A:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqA (A:)
    dkvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hhqB (B:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqB (B:)
    dkvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdslee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hhqC (C:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqC (C:)
    dkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygri
    aprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaq
    ivvvdsle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hhqD (D:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqD (D:)
    kvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygriap
    rsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqiv
    vvdsl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hhqE (E:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqE (E:)
    dkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygri
    aprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaq
    ivvvdsle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3hhqF (F:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqF (F:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3hhqG (G:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqG (G:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3hhqH (H:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqH (H:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3hhqI (I:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqI (I:)
    dkvlkiqlrsasatvptkgataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsle
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3hhqJ (J:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqJ (J:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3hhqK (K:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqK (K:)
    kvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygriap
    rsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqiv
    vvdslee
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3hhqL (L:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqL (L:)
    dkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygri
    aprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaq
    ivvvdsl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3hhqM (M:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqM (M:)
    dkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygri
    aprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaq
    ivvvdslees
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3hhqN (N:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqN (N:)
    kvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygriap
    rsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqiv
    vvdsl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3hhqO (O:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqO (O:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsle
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3hhqP (P:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqP (P:)
    kvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygriap
    rsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqiv
    vvdsl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3hhqQ (Q:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqQ (Q:)
    kvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygriap
    rsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqiv
    vvdsl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3hhqR (R:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqR (R:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsle
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3hhqS (S:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqS (S:)
    dkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygri
    aprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaq
    ivvvdsl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3hhqT (T:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqT (T:)
    dkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygri
    aprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaq
    ivvvdsle
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3hhqU (U:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqU (U:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsle
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3hhqV (V:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqV (V:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsle
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3hhqW (W:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqW (W:)
    sdkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygr
    iaprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivdda
    qivvvdslee
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3hhqX (X:)
    mgsshhhhhhssglvprgshmtatsdkvlkiqlrsasatvptkgsataagydiyasqdit
    ipamgqgmvstdisftvpvgtygriaprsglavkngiqtgagvvdrdytgevkvvlfnhs
    qrdfaikkgdrvaqlilekivddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhqX (X:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsl