PDB entry 3hhp

View 3hhp on RCSB PDB site
Description: Malate dehydrogenase open conformation
Class: oxidoreductase
Keywords: malate dehydrogenase, MDH, citric acid cycle, TCA cycle, NAD, Oxidoreductase, Tricarboxylic acid cycle
Deposited on 2009-05-15, released 2009-09-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.188
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: mdh, b3236, JW3205
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hhpa1, d3hhpa2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: mdh, b3236, JW3205
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hhpb1, d3hhpb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: mdh, b3236, JW3205
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hhpc1, d3hhpc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: mdh, b3236, JW3205
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hhpd1, d3hhpd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hhpA (A:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgeefvnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hhpB (B:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgeefvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhpB (B:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvrsdlfnvnagivknlvqqvaktcpkacigiitnpvnttvai
    aaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgvtilplls
    qvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvralqgeqg
    vvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlkkdialge
    efvn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hhpC (C:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgeefvnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hhpD (D:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgeefvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhpD (D:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvmdrsdlfnvnagivknlvqqvaktcpkacigiitnpvnttv
    aiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgvtilpl
    lsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvralqge
    qgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlkkdial
    geefvn