PDB entry 3hhn

View 3hhn on RCSB PDB site
Description: Crystal structure of class I ligase ribozyme self-ligation product, in complex with U1A RBD
Class: ligase/RNA
Keywords: Ligase Ribozyme, Ribozyme, Catalytic RNA, Protein-RNA complex, Ribonucleoprotein, RNA-binding, LIGASE/RNA COMPLEX
Deposited on 2009-05-15, released 2009-11-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.202
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-96)
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.05: d3hhnb_
  • Chain 'C':
    Compound: Class I ligase ribozyme, self-ligation product
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-96)
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.05: d3hhnd_
  • Chain 'E':
    Compound: Class I ligase ribozyme, self-ligation product
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hhnB (B:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhnB (B:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiakmk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hhnD (D:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhnD (D:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

  • Chain 'E':
    No sequence available.