PDB entry 3hhi

View 3hhi on RCSB PDB site
Description: Crystal Structure of Cathepsin B from T. brucei in complex with CA074
Class: hydrolase
Keywords: cysteine protease, occluding loop, Hydrolase, Protease, Thiol protease
Deposited on 2009-05-15, released 2010-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.148
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin B-like cysteine protease
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.6.560, tbCatB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6R7Z5
      • engineered (193)
    Domains in SCOPe 2.06: d3hhia_
  • Chain 'B':
    Compound: Cathepsin B-like cysteine protease
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.6.560, tbCatB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6R7Z5
      • engineered (193)
    Domains in SCOPe 2.06: d3hhib_
  • Heterogens: 074, TRS, GOL, MG, LI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hhiA (A:)
    alvaedapvlskafvdrvnrlnrgiwkakydgvmqnitlreakrlngvikknnnasilpk
    rrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfctmggvq
    dvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhskskngy
    ppcsqfnfdtpkcdytcddptipvvnyrswtsyalqgeddymrelffrgpfevafdvyed
    fiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflirrgsse
    cgiedggsagiplapntahhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhiA (A:)
    silpkrrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfct
    mggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhsk
    skngyppcsqfnfdtpkcdytcddptipvvnyrswtsyalqgeddymrelffrgpfevaf
    dvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflir
    rgssecgiedggsagipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hhiB (B:)
    alvaedapvlskafvdrvnrlnrgiwkakydgvmqnitlreakrlngvikknnnasilpk
    rrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfctmggvq
    dvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhskskngy
    ppcsqfnfdtpkcdytcddptipvvnyrswtsyalqgeddymrelffrgpfevafdvyed
    fiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflirrgsse
    cgiedggsagiplapntahhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhiB (B:)
    silpkrrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfct
    mggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhsk
    skngyppcsqfnfdtpkcdytcddptipvvnyrswtsyalqgeddymrelffrgpfevaf
    dvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflir
    rgssecgiedggsagiplap