PDB entry 3hhh

View 3hhh on RCSB PDB site
Description: Crystal structure of transcriptional regulator, a member of PadR family, from Enterococcus faecalis V583
Class: transcription regulator
Keywords: transcriptional regulator, PadR family, PF03551, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION REGULATOR
Deposited on 2009-05-15, released 2009-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR family
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: EF_1297
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hhha_
  • Chain 'B':
    Compound: Transcriptional regulator, PadR family
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: EF_1297
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hhhb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hhhA (A:)
    snamkqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknq
    wviaekkpsekgpmrkfyrltssgeaeladfwqrwtllskqvnkmkknggiehvkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhhA (A:)
    kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia
    ekkpsepmrkfyrltssgeaeladfwqrwtllskqvnkmkkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hhhB (B:)
    snamkqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknq
    wviaekkpsekgpmrkfyrltssgeaeladfwqrwtllskqvnkmkknggiehvkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhhB (B:)
    kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia
    ekkpsekgpmrkfyrltssgeaeladfwqrwtllskqvnkmkk