PDB entry 3hff

View 3hff on RCSB PDB site
Description: Monomeric human Cu,Zn Superoxide dismutase without Zn ligands
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, SOD1, MONOMERIC MUTANT, Amyotrophic lateral sclerosis, Antioxidant, Disease mutation, Disulfide bond, Metal-binding, Neurodegeneration, Phosphoprotein
Deposited on 2009-05-11, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-End)
      • engineered (5)
      • engineered (49)
      • engineered (82)
      • engineered (110)
    Domains in SCOPe 2.07: d3hffa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hffA (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
    gpsfnplsrksggpkdeersvgslgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hffA (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheevgslgnvtad
    kdgvadvsiedsvislsgdhaiigrtlvvhekaddlgkggnnagsrlacgvigia