PDB entry 3hfa

View 3hfa on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome open-gate mutant
Class: hydrolase
Keywords: Crystallography, X-Ray, Mycobacterium tuberculosis, Proteasome Endopeptidase, open gate, mutant, Hydrolase, Proteasome
Deposited on 2009-05-11, released 2009-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.175
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfa1_
  • Chain '2':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfa2_
  • Chain 'A':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfaa_
  • Chain 'B':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfab_
  • Chain 'C':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfac_
  • Chain 'D':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfad_
  • Chain 'E':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfae_
  • Chain 'F':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfaf_
  • Chain 'G':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfag_
  • Chain 'H':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfah_
  • Chain 'I':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfai_
  • Chain 'J':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfaj_
  • Chain 'K':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfak_
  • Chain 'L':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfal_
  • Chain 'M':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfam_
  • Chain 'N':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfan_
  • Chain 'O':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfao_
  • Chain 'P':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfap_
  • Chain 'Q':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfaq_
  • Chain 'R':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfar_
  • Chain 'S':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfas_
  • Chain 'T':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfat_
  • Chain 'U':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfau_
  • Chain 'V':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfav_
  • Chain 'W':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfaw_
  • Chain 'X':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfax_
  • Chain 'Y':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
      • insertion (0)
    Domains in SCOPe 2.07: d3hfay_
  • Chain 'Z':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hfaz_
  • Heterogens: DMF, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3hfa1 (1:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfa1 (1:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3hfa2 (2:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfa2 (2:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hfaA (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaA (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hfaB (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaB (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hfaC (C:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaC (C:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hfaD (D:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaD (D:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragvaslevavldanrprrafrritgsalqall
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hfaE (E:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaE (E:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3hfaF (F:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaF (F:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3hfaG (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaG (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3hfaH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3hfaI (I:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaI (I:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3hfaJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3hfaK (K:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaK (K:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3hfaL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3hfaM (M:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaM (M:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3hfaN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3hfaO (O:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaO (O:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3hfaP (P:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaP (P:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3hfaQ (Q:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaQ (Q:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3hfaR (R:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaR (R:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3hfaS (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaS (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3hfaT (T:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaT (T:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3hfaU (U:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaU (U:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3hfaV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadt
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3hfaW (W:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaW (W:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3hfaX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsga
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3hfaY (Y:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaY (Y:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3hfaZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hfaZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsga