PDB entry 3hf9

View 3hf9 on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome open-gate mutant modified by inhibitor GL1
Class: hydrolase
Keywords: Binding Sites, Oxazolidin-2-one, Crystallography, X-Ray, Mycobacterium tuberculosis, Protease Inhibitors, Proteasome Endopeptidase Complex, Protein Subunits, Substrate Specificity, open gate, mutant, Hydrolase, Proteasome
Deposited on 2009-05-11, released 2009-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.22
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf91_
  • Chain '2':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf92_
  • Chain '3':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf93_
  • Chain '4':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3hf94_
  • Chain 'A':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9a_
  • Chain 'B':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9b_
  • Chain 'C':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9c_
  • Chain 'D':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9d_
  • Chain 'E':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9e_
  • Chain 'F':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9f_
  • Chain 'G':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9g_
  • Chain 'H':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9h_
  • Chain 'I':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9i_
  • Chain 'J':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9j_
  • Chain 'K':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9k_
  • Chain 'L':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9l_
  • Chain 'M':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9m_
  • Chain 'N':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9n_
  • Chain 'O':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9o_
  • Chain 'P':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9p_
  • Chain 'Q':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9q_
  • Chain 'R':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9r_
  • Chain 'S':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9s_
  • Chain 'T':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9t_
  • Chain 'U':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9u_
  • Chain 'V':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9v_
  • Chain 'W':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9w_
  • Chain 'X':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9x_
  • Chain 'Y':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf9y_
  • Chain 'Z':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • insertion (0)
    Domains in SCOPe 2.07: d3hf9z_
  • Chain 'a':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'd':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'f':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'h':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'i':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'k':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'm':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'o':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'q':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 's':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'u':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'w':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Chain 'y':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3hf91 (1:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf91 (1:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqall
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3hf92 (2:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf92 (2:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >3hf93 (3:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf93 (3:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqal
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >3hf94 (4:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf94 (4:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hf9A (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9A (A:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hf9B (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9B (B:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqall
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hf9C (C:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9C (C:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hf9D (D:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9D (D:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hf9E (E:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9E (E:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3hf9F (F:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9F (F:)
    ksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfnefdnlrrggiqfadtrgy
    aydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevahygetkrpelyritydgsi
    adephfvvmggttepianalkesyaenasltdalriavaalravaslevavldanrprra
    frritgsalqall
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3hf9G (G:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9G (G:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3hf9H (H:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9H (H:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3hf9I (I:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9I (I:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqallv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3hf9J (J:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9J (J:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3hf9K (K:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9K (K:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqall
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3hf9L (L:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9L (L:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3hf9M (M:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9M (M:)
    mrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfnefd
    nlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevahyge
    tkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalrava
    slevavldanrprrafrritgsalq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3hf9N (N:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9N (N:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3hf9O (O:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9O (O:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqall
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3hf9P (P:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9P (P:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3hf9Q (Q:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9Q (Q:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqall
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3hf9R (R:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9R (R:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3hf9S (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9S (S:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqall
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3hf9T (T:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9T (T:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3hf9U (U:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9U (U:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqall
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3hf9V (V:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9V (V:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3hf9W (W:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9W (W:)
    aksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfnefdnlrrggiqfadtrg
    yaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevahygetkrpelyritydgs
    iadephfvvmggttepianalkesyaenasltdalriavaalravaslevavldanrprr
    afrritgsalqal
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3hf9X (X:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9X (X:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3hf9Y (Y:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9Y (Y:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    avaslevavldanrprrafrritgsalqal
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3hf9Z (Z:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf9Z (Z:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalalpllagydihasdpqsagrivsfda
    aggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpd
    lvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    No sequence available.

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    No sequence available.

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.