PDB entry 3hf2

View 3hf2 on RCSB PDB site
Description: Crystal structure of the I401P mutant of cytochrome P450 BM3
Class: oxidoreductase
Keywords: P450 FAMILY PROTEIN FOLD, OXIDOREDUCTASE, Electron transport, FAD, Flavoprotein, FMN, Heme, Iron, Metal-binding, Monooxygenase, Multifunctional enzyme, NADP, Transport
Deposited on 2009-05-10, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional P-450/NADPH-P450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: P450BM-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779
      • engineered (401)
    Domains in SCOPe 2.07: d3hf2a_
  • Chain 'B':
    Compound: Bifunctional P-450/NADPH-P450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: P450BM-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779
      • engineered (401)
    Domains in SCOPe 2.07: d3hf2b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hf2A (A:)
    mtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlik
    eacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhamm
    vdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvr
    aldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmln
    gkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlv
    dpvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipq
    lhrdktiwgddveefrperfenpsaipqhafkpfgngqracpgqqfalheatlvlgmmlk
    hfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkvrkkaenahn
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf2A (A:)
    mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
    srfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiav
    qlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphsmvraldeamenk
    rqfqedikvmndlvdkiiadrqsddllthmlngkdpetgeplddeniryqiitfliaghe
    ttsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvlnealrlwpt
    apafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperfenpsaipq
    hafkpfgngqracpgqqfalheatlvlgmmlkhfdfedhtnyeldiketltlkpegfvvk
    akskkipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hf2B (B:)
    mtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlik
    eacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhamm
    vdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvr
    aldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmln
    gkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlv
    dpvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipq
    lhrdktiwgddveefrperfenpsaipqhafkpfgngqracpgqqfalheatlvlgmmlk
    hfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkvrkkaenahn
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf2B (B:)
    mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
    srfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiav
    qlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqsmvraldekrqfqed
    ikvmndlvdkiiadreqsddllthmlngkdpetgeplddeniryqiitfliaghettsgl
    lsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvlnealrlwptapafs
    lyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperfenpsaipqhafkp
    fgngqracpgqqfalheatlvlgmmlkhfdfedhtnyeldiketltlkpegfvvkakskk
    ipl