PDB entry 3hem

View 3hem on RCSB PDB site
Description: Structure of Mycobacterium tuberculosis Mycolic Acid Cyclopropane Synthase CmaA2 in Complex with Dioctylamine
Class: transferase
Keywords: Protein-ligand complex, Cytoplasm, Lipid synthesis, Methyltransferase, S-adenosyl-L-methionine, Transferase
Deposited on 2009-05-09, released 2009-06-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.243
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclopropane-fatty-acyl-phospholipid synthase 2
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cma2, cmaA2, MT0524, MTCY20G9.30c, Rv0503c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5P0 (Start-301)
      • conflict (273)
    Domains in SCOPe 2.01: d3hema_
  • Heterogens: D22, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hemA (A:)
    mtsqgdttsgtqlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyak
    rklaldklnlepgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevds
    prrkevriqgweefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrml
    lhtitipdkeeaqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkvery
    hriganyvptlnawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftl
    vk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hemA (A:)
    qlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldklnle
    pgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgw
    eefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkee
    aqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkveryhriganyvptl
    nawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftlvk