PDB entry 3heb

View 3heb on RCSB PDB site
Description: Crystal Structure of Response regulator receiver domain from Rhodospirillum rubrum
Class: transcription regulator
Keywords: NYSGXRC, PSI-II, receiver domain, respose regulator, 11237b, Protein structure Initiative, structural genomics, New York SGX Research Center for Structural Genomics, transcription regulator
Deposited on 2009-05-08, released 2009-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver domain protein (CheY)
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0665
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RWM6 (Start-143)
      • expression tag (144-145)
    Domains in SCOPe 2.07: d3heba1, d3heba2
  • Chain 'B':
    Compound: Response regulator receiver domain protein (CheY)
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0665
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RWM6 (Start-143)
      • expression tag (144-145)
    Domains in SCOPe 2.07: d3hebb1, d3hebb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hebA (A:)
    mslsvtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagra
    qlvlldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpv
    nyenfanairqlglffsvmqvpeteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hebA (A:)
    vtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagraqlvl
    ldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpvnyen
    fanairqlglffsvmqvpeteg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hebB (B:)
    mslsvtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagra
    qlvlldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpv
    nyenfanairqlglffsvmqvpeteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hebB (B:)
    vtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagraqlvl
    ldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpvnyen
    fanairqlglffsvmqvpeteg