PDB entry 3hdz

View 3hdz on RCSB PDB site
Description: Identification, Synthesis, and SAR of Amino Substituted Pyrido[3,2b]pryaziones as Potent and Selective PDE5 Inhibitors
Class: hydrolase
Keywords: PDE5, PDE-5, inhibition, Alternative splicing, cAMP, Hydrolase, Phosphoprotein, Polymorphism Allosteric enzyme, cGMP, cGMP-binding, Magnesium, Metal-binding, Nucleotide-binding, Zinc
Deposited on 2009-05-07, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase,cAMP-specific 3',5'-cyclic phosphodiesterase 4A,cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (Start-121)
    • Uniprot P27815 (122-145)
    • Uniprot O76074 (147-323)
      • conflict (216)
    Domains in SCOPe 2.07: d3hdza_
  • Heterogens: PD6, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hdzA (A:)
    etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl
    crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl
    dhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdzA (A:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlki
    ikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpiq
    qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv
    sedcfplldgcrknrqkwqalae