PDB entry 3hdl

View 3hdl on RCSB PDB site
Description: Crystal Structure of Highly Glycosylated Peroxidase from Royal Palm Tree
Class: oxidoreductase
Keywords: peroxidase, palm tree, Glycosylated, OXIDOREDUCTASE
Deposited on 2009-05-07, released 2009-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Royal Palm Tree Peroxidase
    Species: Roystonea regia [TaxId:145709]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3HDL (0-303)
    Domains in SCOPe 2.07: d3hdla_
  • Heterogens: HEM, CA, PEO, SO4, MES, EDO, XYZ, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hdlA (A:)
    dlqigfyntscptaeslvqqavaaafannsgiapglirmhfhdcfvrgcdasvlldstan
    ntaekdaipnnpslrgfevitaaksaveaacpqtvscadilafaardsanlagnityqvp
    sgrrdgtvslaseanaqipsplfnatqlinsfanktltademvtlsgahsigvahcssft
    nrlynfnsgsgidptlspsyaallrntcpanstrftpitvsldiitpsvldnmyytgvql
    tlglltsdqalvteanlsaavkanamnltawaskfaqamvkmgqievltgtqgeirtncs
    vvns