PDB entry 3hdg

View 3hdg on RCSB PDB site
Description: Crystal structure of the N-terminal domain of an uncharacterized protein (WS1339) from Wolinella succinogenes
Class: structural genomics, unknown function
Keywords: two-component sensor activity, response regulator, PSI-II, 11227f, NYSGXRC, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, unknown function
Deposited on 2009-05-07, released 2009-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.223
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Wolinella succinogenes [TaxId:844]
    Gene: WS1339
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MRH8 (Start-128)
      • expression tag (129)
    Domains in SCOPe 2.07: d3hdga1, d3hdga2
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Wolinella succinogenes [TaxId:844]
    Gene: WS1339
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MRH8 (Start-128)
      • expression tag (129)
    Domains in SCOPe 2.07: d3hdgb1, d3hdgb2
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Wolinella succinogenes [TaxId:844]
    Gene: WS1339
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MRH8 (Start-128)
      • expression tag (129)
    Domains in SCOPe 2.07: d3hdgd1, d3hdgd2
  • Chain 'E':
    Compound: Uncharacterized protein
    Species: Wolinella succinogenes [TaxId:844]
    Gene: WS1339
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MRH8 (Start-128)
      • expression tag (129)
    Domains in SCOPe 2.07: d3hdge1, d3hdge2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hdgA (A:)
    mslrevalkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdir
    mpklgglemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetle
    dfrhiklakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdgA (A:)
    alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg
    lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik
    lake
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hdgB (B:)
    mslrevalkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdir
    mpklgglemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetle
    dfrhiklakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdgB (B:)
    valkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklg
    glemldrikaggakpyvivissemkyfikaielgvhlflpkpiepgrlmetledfrhikl
    ake
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hdgD (D:)
    mslrevalkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdir
    mpklgglemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetle
    dfrhiklakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdgD (D:)
    alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg
    lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik
    lake
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hdgE (E:)
    mslrevalkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdir
    mpklgglemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetle
    dfrhiklakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdgE (E:)
    alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg
    lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik
    lake