PDB entry 3hck

View 3hck on RCSB PDB site
Description: NMR ensemble of the uncomplexed human HCK SH2 domain, 20 structures
Deposited on 1997-03-31, released 1997-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3hck__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hck_ (-)
    meteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhy
    kirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmssk