PDB entry 3hc4

View 3hc4 on RCSB PDB site
Description: BHA10 IgG1 Fab quadruple mutant variant - antibody directed at human LTBR
Class: immune system
Keywords: igg1 fab, bha10, immune system
Deposited on 2009-05-05, released 2009-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.162
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin IgG1 Fab, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HC4 (0-212)
  • Chain 'L':
    Compound: immunoglobulin IgG1 Fab, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HC4 (0-212)
    Domains in SCOPe 2.05: d3hc4l1, d3hc4l2
  • Heterogens: ACT, ZN, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hc4L (L:)
    diqmtqspsslsasvgdrvtitckasqnvginvawyqqkpgkapkllissasyrysgvps
    rfsgsgsgtdftltisslqpedfatyfcqqydtypftfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge