PDB entry 3hc3

View 3hc3 on RCSB PDB site
Description: BHA10 IgG1 Fab double mutant variant - antibody directed at human LTBR
Class: immune system
Keywords: igg1 fab, bha10, immune system
Deposited on 2009-05-05, released 2009-08-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.16
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: immunoglobulin IgG1 Fab, light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3HC3 (0-216)
• Chain 'L':
  Compound: immunoglobulin IgG1 Fab, heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3HC3 (0-212)
  Domains in SCOPe 2.04: d3hc3l1, d3hc3l2
• Heterogens: ACT, ZN, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hc3L (L:)
  diqmtqspsslsasvgdrvtitckasqnvginvawyqqkpgkapkllissasyrysgvps
  rfsgsgsgtdftltisslqpedfatyfcqqydtypftfgqgtkveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrge