PDB entry 3hbw

View 3hbw on RCSB PDB site
Description: Crystal Structure of Human Fibroblast Growth Factor Homologous Factor 2A (FHF2A), also referred to as Fibroblast Growth Factor 13A (FGF13A)
Class: hormone
Keywords: beta-trefoil fold, Alternative splicing, Growth factor, Polymorphism, HORMONE
Deposited on 2009-05-05, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor 13
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF13, FHF2, fibroblast growth factor homologous factor 2 (FHF2)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hbwa_
  • Chain 'B':
    Compound: Fibroblast growth factor 13
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF13, FHF2, fibroblast growth factor homologous factor 2 (FHF2)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hbwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hbwA (A:)
    gskkrrrrrpepqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvv
    aiqgvqtklylamnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylg
    lnkegeimkgnhvkknkpaahflpkplkvamykepslhdltefsrsgsgtptksrsvsgv
    lnggksmshnest
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbwA (A:)
    pqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvvaiqgvqtklyl
    amnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylglnkegeimkgn
    hvkknkpaahflpkplkvamykepslhdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hbwB (B:)
    gskkrrrrrpepqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvv
    aiqgvqtklylamnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylg
    lnkegeimkgnhvkknkpaahflpkplkvamykepslhdltefsrsgsgtptksrsvsgv
    lnggksmshnest
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbwB (B:)
    pqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvvaiqgvqtklyl
    amnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylglnkegeimkgn
    hvkknkpaahflpkplkvamykepslhdl