PDB entry 3hbp

View 3hbp on RCSB PDB site
Description: The crystal structure of C185S mutant of recombinant sulfite oxidase with bound substrate, sulfite, at the active site
Class: oxidoreductase
Keywords: metal binding, molybdenum, oxotransferase, molybdopterin, sulfite oxidase, OXIDOREDUCTASE
Deposited on 2009-05-04, released 2010-04-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.181
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfite Oxidase mutant C185S
    Species: Gallus gallus [TaxId:9031]
    Gene: sulfite oxidase
    Database cross-references and differences (RAF-indexed):
    • PDB 3HBP (Start-465)
    Domains in SCOPe 2.03: d3hbpa1, d3hbpa2
  • Heterogens: MTE, MOM, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hbpA (A:)
    apsypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwa
    lyavhgephvlellqqykvgelspdeapaapdaqdpfagdpprhpglrvnsqkpfnaepp
    aellaerfltpnelfftrnhlpvpavepssyrlrvdgpgggtlslslaelrsrfpkhevt
    atlqsagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhagfpeelqgewhvcf
    egldadpggapygasipygralspaadvllayemngtelprdhgfpvrvvvpgvvgarsv
    kwlrrvavspdespshwqqndykgfspcvdwdtvdyrtapaiqelpvqsavtqprpgaav
    ppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgrawawalweltvpve
    agteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbpA (A:)
    qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
    rvdgpgggtlslslaelrsrfpkhevtatlqsagnrrsemsrvrpvkglpwdigaistar
    wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
    mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdt
    vdyrtapaiqelpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwk
    varlmgdkappgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvl
    stawhrvrvsvqd