PDB entry 3hbh

View 3hbh on RCSB PDB site
Description: Class IV chitinase structure from Picea abies at 2.25A
Class: hydrolase
Keywords: endochitinase, chitinase, class IV, family 19, conformational changes, Chitin-binding, Glycosidase, Hydrolase
Deposited on 2009-05-04, released 2009-08-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.157
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Class IV chitinase Chia4-Pa2
  Species: Picea abies [TaxId:3329]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6WSR8 (0-203)
  Domains in SCOPe 2.01: d3hbha_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hbhA (A:)
  svggiisqsffnglaggaasscegkgfytynafiaaanaysgfgttgsndvkkrelaaff
  anvmhetgglcyineknppinycqssstwpctsgksyhgrgplqlswnynygaagksigf
  dglnnpekvgqdstisfktavwfwmknsnchsaitsgqgfggtikainsmecnggnsgev
  ssrvnyykkicsqlgvdpganvsc