PDB entry 3hbg

View 3hbg on RCSB PDB site
Description: Structure of recombinant Chicken Liver Sulfite Oxidase mutant C185S
Class: oxidoreductase
Keywords: sulfite oxidase, molybdenum, molybdopterin, oxotransferase, OXIDOREDUCTASE
Deposited on 2009-05-04, released 2010-04-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfite Oxidase mutant C185S
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HBG (Start-465)
    Domains in SCOPe 2.03: d3hbga1, d3hbga2
  • Heterogens: MTE, MOM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hbgA (A:)
    apsypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwa
    lyavhgephvlellqqykvgelspdeapaapdaqdpfagdpprhpglrvnsqkpfnaepp
    aellaerfltpnelfftrnhlpvpavepssyrlrvdgpgggtlslslaelrsrfpkhevt
    atlqsagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhagfpeelqgewhvcf
    egldadpggapygasipygralspaadvllayemngtelprdhgfpvrvvvpgvvgarsv
    kwlrrvavspdespshwqqndykgfspcvdwdtvdyrtapaiqelpvqsavtqprpgaav
    ppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgrawawalweltvpve
    agteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbgA (A:)
    qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
    rvdgpgggtlslslaelrsrfpkhevtatlqsagnrrsemsrvrpvkglpwdigaistar
    wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
    mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdepcvdwdtpaiqelpvqsavtq
    prpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgrawawalw
    eltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd