PDB entry 3ha5

View 3ha5 on RCSB PDB site
Description: Crystal structure of HMA (MMAA4) from mycobacterium tuberculosis complexed with sinefungin
Class: transferase
Keywords: S-ADENOSYLMETHIONINE-DEPENDENT METHYLTRANSFERASE FOLD, Methyltransferase, Transferase
Deposited on 2009-05-01, released 2009-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methoxy mycolic acid synthase 4
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: mmaA4, MMAA4 (RV0642C), Rv0642c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ha5a_
  • Heterogens: SFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ha5A (A:)
    mgsshyhhhhssglvprgshmaekpisptktrtrfediqahydvsddffalfqdptrtys
    cayfeppeltleeaqyakvdlnldkldlkpgmtlldigcgwgttmrraverfdvnviglt
    lsknqharceqvlasidtnrsrqvllqgwedfaepvdrivsieafehfghenyddffkrc
    fnimpadgrmtvqssvsyhpyemaargkklsfetarfikfivteifpggrlpstemmveh
    gekagftvpeplslrphyiktlriwgdtlqsnkdkaievtseevynrymkylrgcehyft
    demldcslvtylkpgaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ha5A (A:)
    iqahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldi
    gcgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvd
    rivsieafehfghenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarf
    ikfivteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkai
    evtseevynrymkylrgcehyftdemldcslvtylkpgaaa