PDB entry 3h9y

View 3h9y on RCSB PDB site
Description: Crystal structure of the IgE-Fc3-4 domains
Class: immune system
Keywords: Immunoglobin, IgE, Fc, flexibility, hydrophobic pocket, Disulfide bond, Glycoprotein, Immunoglobulin C region, Immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2009-04-30, released 2009-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854
      • engineered (46)
      • engineered (58)
    Domains in SCOPe 2.07: d3h9ya1, d3h9ya2
  • Chain 'B':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854
      • engineered (46)
      • engineered (58)
    Domains in SCOPe 2.07: d3h9yb1, d3h9yb2
  • Chain 'E':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854
      • engineered (46)
      • engineered (58)
    Domains in SCOPe 2.07: d3h9ye1, d3h9ye2
  • Heterogens: NAG, BMA, MAN, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h9yA (A:)
    adpcadsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqh
    strkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraape
    vyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgff
    vfsrlevtraeweqkdeficravheaaspsqtvqravsvnpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h9yA (A:)
    vsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrng
    tltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpg
    srdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtrae
    weqkdeficravheaaspsqtvqravsvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h9yB (B:)
    adpcadsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqh
    strkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraape
    vyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgff
    vfsrlevtraeweqkdeficravheaaspsqtvqravsvnpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h9yB (B:)
    gvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrn
    gtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewp
    gsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtra
    eweqkdeficravheaaspsqtvqravsvn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3h9yE (E:)
    adpcadsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqh
    strkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraape
    vyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgff
    vfsrlevtraeweqkdeficravheaaspsqtvqravsvnpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h9yE (E:)
    vsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrng
    tltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpg
    srdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtrae
    weqkdeficravheaaspsqtvqravsvn