PDB entry 3h9n

View 3h9n on RCSB PDB site
Description: Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target IR66.
Class: ribosomal protein
Keywords: Crystal Structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, IR66, rimM, Chaperone, Cytoplasm, Ribosome biogenesis, RIBOSOMAL PROTEIN
Deposited on 2009-04-30, released 2009-05-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribosome maturation factor rimM
  Species: Haemophilus influenzae [TaxId:727]
  Gene: HI0203, rimM
  Database cross-references and differences (RAF-indexed):
  • Uniprot P44568 (0-170)
    • expression tag (171-176)
  Domains in SCOPe 2.05: d3h9na1, d3h9na2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3h9nA (A:)
  hievvgklgstygirgwlriyssteqaesifdyqpwflkikgewqsielenwryhnheii
  vklkgvddreaaqilanveigvdlsvfpeleegdyywhdligctvvnlegytmgtvtemm
  etgsndvlvvkantkdafgkqerlipflyeqvvkrvdlttktievdwdagflehhhh