PDB entry 3h9d

View 3h9d on RCSB PDB site
Description: Crystal Structure of Trypanosoma brucei ATG8
Class: structural protein
Keywords: autophagy, lipidation, ubiquitin-like, Trypanosoma brucei, STRUCTURAL PROTEIN
Deposited on 2009-04-30, released 2009-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein 1A/1B, light chain 3, putative
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h9da_
  • Chain 'B':
    Compound: Microtubule-associated protein 1A/1B, light chain 3, putative
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h9db_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h9dA (A:)
    mskkdskykmshtfesrqsdaakvrerhpdrlpiicekvynsdigeldrckflvpsdltv
    gqfvsvlrkrvqleaesalfvytndtvlpssaqmadiyskykdedgflymkysgeatfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h9dA (A:)
    kdskykmshtfesrqsdaakvrerhpdrlpiicekvynsdigeldrckflvpsdltvgqf
    vsvlrkrvqleaesalfvytndtvlpssaqmadiyskykdedgflymkysgeatfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h9dB (B:)
    mskkdskykmshtfesrqsdaakvrerhpdrlpiicekvynsdigeldrckflvpsdltv
    gqfvsvlrkrvqleaesalfvytndtvlpssaqmadiyskykdedgflymkysgeatfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h9dB (B:)
    kdskykmshtfesrqsdaakvrerhpdrlpiicekvynsdigeldrckflvpsdltvgqf
    vsvlrkrvqleaesalfvytndtvlpssaqmadiyskykdedgflymkysgeatfg