PDB entry 3h8s

View 3h8s on RCSB PDB site
Description: Structure of D19N T4 RNase H in the presence of divalent magnesium
Class: hydrolase
Keywords: HYDROLASE, BPT4 RNase H, 5'-3' exonuclease, Endonuclease, Nuclease
Deposited on 2009-04-29, released 2010-05-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 33.2, das, rnh
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13319 (Start-304)
      • engineered (18)
    Domains in SCOPe 2.04: d3h8sa1, d3h8sa2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h8sA (A:)
    mdlemmldedykegiclinfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkakt
    lgytkivlcidnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaymp
    yivmdidkyeaddhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
    ksgsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqak
    vllteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltn
    sinef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8sA (A:)
    ykegiclinfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlci
    dnaksgywrrdfayyykktwdwegyfesshkvidelkaympyivmdidkyeaddhiavlv
    kkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvkigsaeidcmtkilkgdkkdn
    vasvkvrsdfwftrvegertpsmktsiveaiandreqakvllteseynrykenlvlidfd
    yipdniasnivnyynsyklpprgkiysyfvkaglskltnsinef