PDB entry 3h8n

View 3h8n on RCSB PDB site
Description: Crystal Structure Analysis of KIR2DS4
Class: immune system
Keywords: ligand-binding domains, Cell membrane, Disulfide bond, Glycoprotein, Immunoglobulin domain, Membrane, Polymorphism, Receptor, Transmembrane, IMMUNE SYSTEM
Deposited on 2009-04-29, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Killer cell immunoglobulin-like receptor 2DS4
  Species: Homo sapiens [TaxId:9606]
  Gene: CD158I, KIR2DS4, KIR2DS4*0010101, KKA3, NKAT8
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43632 (0-194)
  Domains in SCOPe 2.07: d3h8na1, d3h8na2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3h8nA (A:)
  rkpsflalpghlvkseetvilqcwsdvmfehfllhregkfnntlhligehhdgvskanfs
  igpmmpvlagtyrcygsvphspyqlsapsdpldmviiglyekpslsaqpgptvqagenvt
  lscssrssydmyhlsregeaherrlpavrsingtfqadfplgpathggtyrcfgsfrdap
  yewsnssdpllvsvt