PDB entry 3h82

View 3h82 on RCSB PDB site
Description: Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS domains with the artificial ligand THS020
Class: transcription
Keywords: PAS domain, heterodimer, protein ligand complex., Activator, Angiogenesis, Congenital erythrocytosis, Developmental protein, Differentiation, Disease mutation, DNA-binding, Hydroxylation, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Ubl conjugation, Alternative splicing, Polymorphism
Deposited on 2009-04-28, released 2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial PAS domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPAS1, HIF2A, Hypoxia Inducible Factor 2 alpha, MOP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99814 (5-End)
      • expression tag (1-4)
      • engineered (13)
    Domains in SCOPe 2.08: d3h82a1, d3h82a2
  • Chain 'B':
    Compound: Aryl hydrocarbon receptor nuclear translocator
    Species: Homo sapiens [TaxId:9606]
    Gene: ARNT, Aryl Hydrocarbon Receptor Nuclear Translocator, BHLHE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27540 (6-End)
      • expression tag (5)
      • engineered (12)
    Domains in SCOPe 2.08: d3h82b1, d3h82b2
  • Heterogens: 020, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3h82A (A:)
gefkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtksh
qnlctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn

    Sequence, based on observed residues (ATOM records): (download) 
    >3h82A (A:)
efkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshq
nlctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3h82B (B:)
gefkglnvcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllr
dsfqqvvklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknssq
e

    Sequence, based on observed residues (ATOM records): (download) 
    >3h82B (B:)
lnvcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqq
vvklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns