PDB entry 3h7c

View 3h7c on RCSB PDB site
Description: Crystal Structure of Arabidopsis thaliana Agmatine Deiminase from Cell Free Expression
Class: hydrolase
Keywords: Agmatine, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, N-carbamoylputrescine, Arginine decarboxylase pathway, Hydrolase, Polyamine biosynthesis
Deposited on 2009-04-24, released 2009-05-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.147
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: agmatine deiminase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AIH, At5g08170, EMB1873, T22D6.110
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GWW7 (1-End)
      • expression tag (0)
      • see remark 999 (48)
    Domains in SCOPe 2.02: d3h7cx_
  • Heterogens: CL, MG, NA, K, 211, 1PE, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3h7cX (X:)
    seesrespaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepv
    tvcaspaqwenarkqlpedirvvemsmndswfrdsgptfivrkrpvklsslnrniagidw
    nfnawggandgcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteec
    llnknrnphmskeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvlls
    wtddetdpqyersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaip
    rlagtrlaasyvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivla
    ggnihcitqqqpaeptsvaengh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h7cX (X:)
    seesrespaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepv
    tvcaspaqwenarkqlpedirvvemsmndswfrdsgptfivrkrnrniagidwnfnawgg
    andgcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknrn
    phmskeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtddetd
    pqyersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlagtrl
    aasyvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggnihci
    tqqqpaept