PDB entry 3h6m

View 3h6m on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V104E at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, Calcium, Endonuclease, Membrane, Metal-binding, Nuclease
Deposited on 2009-04-23, released 2010-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (43-44)
      • engineered (97)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.08: d3h6ma_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3h6mA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealerqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >3h6mA (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealerqglakvayvykgnntheqllrkaeaqa
kkeklniws