PDB entry 3h6i

View 3h6i on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome Modified by inhibitor GL1
Class: hydrolase
Keywords: Binding Sites, Oxazolidin-2-one, Crystallography, X-Ray, Mycobacterium tuberculosis, Protease Inhibitors, Proteasome Endopeptidase Complex, Protein Subunits, Substrate Specificity, Hydrolase, Proteasome
Deposited on 2009-04-23, released 2009-09-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6i1_
  • Chain '2':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6i2_
  • Chain 'A':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6ia_
  • Chain 'B':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6ib_
  • Chain 'C':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6ic_
  • Chain 'D':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6id_
  • Chain 'E':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6ie_
  • Chain 'F':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6if_
  • Chain 'G':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6ig_
  • Chain 'H':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6ih_
  • Chain 'I':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6ii_
  • Chain 'J':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6ij_
  • Chain 'K':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6ik_
  • Chain 'L':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6il_
  • Chain 'M':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6im_
  • Chain 'N':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6in_
  • Chain 'O':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6io_
  • Chain 'P':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6ip_
  • Chain 'Q':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6iq_
  • Chain 'R':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6ir_
  • Chain 'S':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6is_
  • Chain 'T':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6it_
  • Chain 'U':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6iu_
  • Chain 'V':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6iv_
  • Chain 'W':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6iw_
  • Chain 'X':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6ix_
  • Chain 'Y':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3h6iy_
  • Chain 'Z':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.01: d3h6iz_
  • Heterogens: DMF, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3h6i1 (1:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6i1 (1:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqall
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3h6i2 (2:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6i2 (2:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalpllagydihasdpqsagrivsfdaag
    gwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlv
    rgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h6iA (A:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iA (A:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h6iB (B:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iB (B:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h6iC (C:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iC (C:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalpllagydihasdpqsagrivsfdaag
    gwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlv
    rgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h6iD (D:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iD (D:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragvaslevavldanrprrafrritgsalqall
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3h6iE (E:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iE (E:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3h6iF (F:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iF (F:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragtlgvaslevavldanrprrafrritgsalqall
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3h6iG (G:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iG (G:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3h6iH (H:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iH (H:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnllpllagydihasdpqsagrivsfdaaggw
    nieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlvrg
    ifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3h6iI (I:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iI (I:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3h6iJ (J:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iJ (J:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3h6iK (K:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iK (K:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alraglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3h6iL (L:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iL (L:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3h6iM (M:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iM (M:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3h6iN (N:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iN (N:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnalpllagydihasdpqsagrivsfdaaggw
    nieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlvrg
    ifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3h6iO (O:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iO (O:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3h6iP (P:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iP (P:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3h6iQ (Q:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iQ (Q:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alragtlgvaslevavldanrprrafrritgsalqall
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3h6iR (R:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iR (R:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrsgadtfgs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3h6iS (S:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iS (S:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3h6iT (T:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iT (T:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3h6iU (U:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iU (U:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3h6iV (V:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iV (V:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalpllagydihasdpqsagrivsfdaag
    gwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlv
    rgifptaviidadgavdvpesriaelaraiiesrsgadtfg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3h6iW (W:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iW (W:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alraglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3h6iX (X:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iX (X:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3h6iY (Y:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iY (Y:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragvaslevavldanrprrafrritgsalqall
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3h6iZ (Z:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6iZ (Z:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalpllagydihasdpqsagrivsfdaag
    gwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlv
    rgifptaviidadgavdvpesriaelaraiiesrs