PDB entry 3h6f

View 3h6f on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome Modified by inhibitor HT1171
Class: hydrolase
Keywords: Binding Sites, Oxazolidin-2-one, Crystallography, X-Ray, Mycobacterium tuberculosis, Protease Inhibitors, Proteasome Endopeptidase Complex, Protein Subunits, Substrate Specificity, Hydrolase, Proteasome
Deposited on 2009-04-23, released 2009-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6f1_
  • Chain '2':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6f2_
  • Chain 'A':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fa_
  • Chain 'B':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fb_
  • Chain 'C':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fc_
  • Chain 'D':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fd_
  • Chain 'E':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fe_
  • Chain 'F':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6ff_
  • Chain 'G':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fg_
  • Chain 'H':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fh_
  • Chain 'I':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fi_
  • Chain 'J':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fj_
  • Chain 'K':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fk_
  • Chain 'L':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fl_
  • Chain 'M':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fm_
  • Chain 'N':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fn_
  • Chain 'O':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fo_
  • Chain 'P':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fp_
  • Chain 'Q':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fq_
  • Chain 'R':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fr_
  • Chain 'S':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fs_
  • Chain 'T':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6ft_
  • Chain 'U':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fu_
  • Chain 'V':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fv_
  • Chain 'W':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fw_
  • Chain 'X':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fx_
  • Chain 'Y':
    Compound: Proteasome (Alpha subunit) PrcA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h6fy_
  • Chain 'Z':
    Compound: Proteasome (Beta subunit) PrcB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3h6fz_
  • Heterogens: DMF, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3h6f1 (1:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6f1 (1:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqall
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3h6f2 (2:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6f2 (2:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalpllagydihasdpqsagrivsfdaag
    gwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlv
    rgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h6fA (A:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fA (A:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h6fB (B:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fB (B:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h6fC (C:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fC (C:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalpllagydihasdpqsagrivsfdaag
    gwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlv
    rgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h6fD (D:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fD (D:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raggvaslevavldanrprrafrritgsalqall
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3h6fE (E:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fE (E:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3h6fF (F:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fF (F:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3h6fG (G:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fG (G:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3h6fH (H:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fH (H:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnllpllagydihasdpqsagrivsfdaaggw
    nieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlvrg
    ifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3h6fI (I:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fI (I:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3h6fJ (J:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fJ (J:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3h6fK (K:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fK (K:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3h6fL (L:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fL (L:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3h6fM (M:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fM (M:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alragvaslevavldanrprrafrritgsalqall
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3h6fN (N:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fN (N:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnalpllagydihasdpqsagrivsfdaaggw
    nieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlvrg
    ifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3h6fO (O:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fO (O:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3h6fP (P:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fP (P:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3h6fQ (Q:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fQ (Q:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alraglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3h6fR (R:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fR (R:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrsgadtfgs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3h6fS (S:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fS (S:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3h6fT (T:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fT (T:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3h6fU (U:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fU (U:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3h6fV (V:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fV (V:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalpllagydihasdpqsagrivsfdaag
    gwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlv
    rgifptaviidadgavdvpesriaelaraiiesrsgadtfgs
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3h6fW (W:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fW (W:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alraglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3h6fX (X:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fX (X:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
    ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
    vrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3h6fY (Y:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fY (Y:)
    peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragvaslevavldanrprrafrritgsalqall
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3h6fZ (Z:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h6fZ (Z:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaalpllagydihasdpqsagrivsfdaag
    gwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdlv
    rgifptaviidadgavdvpesriaelaraiiesrs