PDB entry 3h5i

View 3h5i on RCSB PDB site
Description: Crystal structure of the N-terminal domain of a response regulator/sensory box/GGDEF 3-domain protein from Carboxydothermus hydrogenoformans
Class: transcription
Keywords: STRUCTURAL GENOMICS, TRANSCRIPTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-04-22, released 2009-05-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator/sensory box protein/GGDEF domain protein
    Species: Carboxydothermus hydrogenoformans Z-2901 [TaxId:246194]
    Gene: CHY_0880
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3h5ia_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h5iA (A:)
    mslkdkkilivedskfqaktianilnkygytveialtgeaavekvsggwypdlilmdiel
    gegmdgvqtalaiqqiselpvvfltahtepavvekirsvtaygyvmksateqvlitivem
    alrlyeanvhaneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h5iA (A:)
    kkilivedskfqaktianilnkygytveialtgeaavekvsggwypdlilmdielgegmd
    gvqtalaiqqiselpvvfltahtepavvekirsvtaygyvmksateqvlitivemalrly
    eanvh