PDB entry 3h56

View 3h56 on RCSB PDB site
Description: Met150Leu/Phe312Cys variant of nitrite reductase from Alcaligenes faecalis
Class: oxidoreductase
Keywords: nitrite reductase, high-throughput screening, oxidase, copper, FAD, Flavoprotein, Metal-binding, Nitrate assimilation, Oxidoreductase, Periplasm, Pyrrolidone carboxylic acid
Deposited on 2009-04-21, released 2010-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.179
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nir, nirK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-335)
      • engineered (146)
      • engineered (308)
    Domains in SCOPe 2.08: d3h56a1, d3h56a2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3h56A (A:)
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsglngaimvlpreglhdgkgkaltydkiyyvgeqdf
yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
vnhnlieacelgaaahfkvtgewnddlmtsvlapsg