PDB entry 3h55

View 3h55 on RCSB PDB site
Description: Crystal Structure of human alpha-N-acetylgalactosaminidase, Complex with Galactose
Class: hydrolase
Keywords: GLYCOPROTEIN, CARBOHYDRATE-BINDING PROTEIN, GLYCOSIDASE, LYSOSOMAL ENZYME, (BETA/ALPHA)8 BARREL, PROTEIN-LIGAND COMPLEX, Disease mutation, Disulfide bond, Hydrolase, Lysosome
Deposited on 2009-04-21, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Homo sapiens [TaxId:9606]
    Gene: nagA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17050 (0-End)
      • engineered (183)
    Domains in SCOPe 2.07: d3h55a1, d3h55a2
  • Chain 'B':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Homo sapiens [TaxId:9606]
    Gene: nagA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17050 (0-End)
      • engineered (183)
    Domains in SCOPe 2.07: d3h55b1, d3h55b2
  • Heterogens: NAG, BMA, FUC, MAN, GLA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h55A (A:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h55A (A:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h55B (B:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h55B (B:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypik