PDB entry 3h52

View 3h52 on RCSB PDB site
Description: Crystal structure of the antagonist form of human glucocorticoid receptor
Class: hormone receptor
Keywords: protein-ligand complex, nuclear receptor, peptide complex, hormone receptor 3, hormone receptor
Deposited on 2009-04-21, released 2009-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150 (4-End)
      • expression tag (2-3)
      • engineered (78)
      • engineered (114)
      • engineered (160)
      • engineered (164)
      • engineered (188)
    Domains in SCOPe 2.06: d3h52a1, d3h52a2
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150 (4-End)
      • engineered (78)
      • engineered (114)
      • engineered (160)
      • engineered (164)
      • engineered (188)
    Domains in SCOPe 2.06: d3h52b_
  • Chain 'C':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150 (4-End)
      • expression tag (3)
      • engineered (78)
      • engineered (114)
      • engineered (160)
      • engineered (164)
      • engineered (188)
    Domains in SCOPe 2.06: d3h52c1, d3h52c2
  • Chain 'D':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150
      • engineered (78)
      • engineered (114)
      • engineered (160)
      • engineered (164)
      • engineered (188)
    Domains in SCOPe 2.06: d3h52d_
  • Chain 'M':
    Compound: Nuclear receptor corepressor 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Nuclear receptor corepressor 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 486, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h52A (A:)
    gshmltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipg
    frnlhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqc
    khmlyvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivk
    regnssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipk
    ysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h52A (A:)
    hmltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfr
    nlhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckh
    mlyvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkre
    gnssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipgni
    kkllfhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h52B (B:)
    gshmltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipg
    frnlhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqc
    khmlyvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivk
    regnssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipk
    ysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h52B (B:)
    ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl
    hlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhml
    yvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregn
    ssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysng
    nikkllfhq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h52C (C:)
    gshmltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipg
    frnlhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqc
    khmlyvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivk
    regnssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipk
    ysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h52C (C:)
    mltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrn
    lhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhm
    lyvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkreg
    nssqnsqrfyqltklldsmhevvenllnycfqtfaeiitnqipkysngnikkllfhq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h52D (D:)
    gshmltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipg
    frnlhlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqc
    khmlyvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivk
    regnssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipk
    ysngnikkllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h52D (D:)
    ptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnlhl
    ddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhmlyv
    sselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregnss
    qnsqrfyqltklldsmhevvenllnycfqtflemlaeiitnqingnikkllfhq
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.