PDB entry 3h42

View 3h42 on RCSB PDB site
Description: Crystal structure of PCSK9 in complex with Fab from LDLR competitive antibody
Class: hydrolase/immune system
Keywords: Hydrolase, Protein Fab Complex, Autocatalytic cleavage, Cholesterol metabolism, Disease mutation, Disulfide bond, Glycoprotein, Lipid metabolism, Phosphoprotein, Protease, Secreted, Serine protease, Steroid metabolism, Zymogen, HYDROLASE-IMMUNE SYSTEM COMPLEX
Deposited on 2009-04-17, released 2009-05-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: NARC1, PCSK9, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: NARC1, PCSK9, PSEC0052
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBP7 (0-End)
      • engineered (380)
      • see remark 999 (467)
  • Chain 'H':
    Compound: Fab from LDLR competitive antibody: Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H42 (0-End)
  • Chain 'L':
    Compound: Fab from LDLR competitive antibody: Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H42 (0-End)
    Domains in SCOPe 2.04: d3h42l1, d3h42l2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3h42L (L:)
    esvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapkllisgnsnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h42L (L:)
    esvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapkllisgnsnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt