PDB entry 3h3u

View 3h3u on RCSB PDB site
Description: Crystal structure of CRP (cAMP receptor Protein) from Mycobacterium tuberculosis
Class: transcription
Keywords: Apo CRP, Allostery, Dimer, DNA-binding, Transcription, Transcription regulation
Deposited on 2009-04-17, released 2010-02-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.227
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable transcriptional regulatory protein (probably crp/fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv3676
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3h3ua1, d3h3ua2
  • Chain 'B':
    Compound: probable transcriptional regulatory protein (probably crp/fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv3676
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3h3ub1, d3h3ub2
  • Heterogens: SO4, CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h3uA (A:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3uA (A:)
    deilaragifqgaiaaltqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdgrenl
    ltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllrvla
    rrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasr
    etvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h3uB (B:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3uB (B:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlis