PDB entry 3h2p

View 3h2p on RCSB PDB site
Description: Human SOD1 D124V Variant
Class: Oxidoreductase
Keywords: oxidoreductase, human cu, zn superoxide dismutase, antioxidant, metal-binding, copper, zinc, amyotrophic lateral sclerosis, disease mutation, Acetylation, Cytoplasm, Disulfide bond, Phosphoprotein, Ubl conjugation
Deposited on 2009-04-14, released 2010-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.155
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (123)
    Domains in SCOPe 2.07: d3h2pa_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (123)
    Domains in SCOPe 2.07: d3h2pb_
  • Heterogens: ZN, MLI, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h2pA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekavdlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h2pA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnprhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekavagsrlacg
    vigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h2pB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekavdlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h2pB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekavnagsrl
    acgvigiaq