PDB entry 3h1e

View 3h1e on RCSB PDB site
Description: Crystal structure of Mg(2+) and BeH(3)(-)-bound CheY of Helicobacter pylori
Class: signaling protein
Keywords: chemotaxis, BeF3-bound CheY, Cytoplasm, Flagellar rotation, Magnesium, Metal-binding, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on 2009-04-12, released 2010-03-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.154
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY homolog
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: CheY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3h1ea_
  • Heterogens: MG, BEF, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h1eA (A:)
    gplgsmkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitdwn
    mpemngldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkek
    levvlgtnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h1eA (A:)
    mkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitdwnmpemn
    gldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkeklevvl
    gtn