PDB entry 3h1d

View 3h1d on RCSB PDB site
Description: Structure of the HUWE1 HECT Domain
Class: ligase
Keywords: E3Ligase, ubiquitin, HECT, lobe, Alternative splicing, Chromosomal rearrangement, Cytoplasm, Differentiation, Disease mutation, DNA-binding, Ligase, Mental retardation, Nucleus, Phosphoprotein, Ubl conjugation pathway
Deposited on 2009-04-11, released 2009-12-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase HUWE1
    Species: Homo sapiens [TaxId:9606]
    Gene: HUWE1, KIAA0312, KIAA1578, UREB1, HSPC272
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z6Z7 (23-End)
      • expression tag (10-22)
      • engineered (214)
    Domains in SCOPe 2.03: d3h1da_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h1dA (A:)
    mgsshhhhhhssglevlfqgphmdfdvkrkyfrqelerldeglrkedmavhvrrdhvfed
    syrelhrkspeemknrlyivfegeegqdaggllrewymiisremfnpmyalfrtspgdrv
    tytinpsshanpnhlsyfkfvgrivakavydnrllecyftrsfykhilgksvrytdmese
    dyhfyqglvyllendvstlgydltfstevqefgvaevrdlkpnganilvteenkkeyvhl
    vcqmrmtgairkqlaaflegfyeiipkrlisifteqelellisglptididdlksnteyh
    kyqsnsiqiqwfwralrsfdqadrakflqfvtgtskvplqgfaalegmngiqkfqihrdd
    rstdrlpsahtcfnqldlpayesfeklrhmlllaiqeasegfgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h1dA (A:)
    ssglevlfqgphmdfdvkrkyfrqelerldeglrkedmavhvrrdhvfedsyrelhrksp
    eemknrlyivfegeegqdaggllrewymiisremfnpmyalfrtspgdrvtytinpsnhl
    syfkfvgrivakavydnrllecyftrsfykhilgksvrytdmesedyhfyqglvyllend
    vstlgydltfstevqefgvaevrdlkpnganilvteenkkeyvhlvcqmrmtgairkqla
    aflegfyeiipkrlisifteqelellisglptididdlksnteyhkyqsnsiqiqwfwra
    lrsfdqadrakflqfvtgtskvplqgfaalegmngiqkfqihrddrstdrlpsahtcfnq
    ldlpayesfeklrhmlllaiqe