PDB entry 3h18

View 3h18 on RCSB PDB site
Description: Crystal structure of EstE5-PMSF (II)
Class: hydrolase
Keywords: HSL, EstE5, esterase, lipase, HYDROLASE, PMSF, Phenylmethylsulfonyl fluoride
Deposited on 2009-04-11, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: estE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h18a_
  • Heterogens: PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h18A (A:)
    masmtggqqmgrgmagpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqve
    qvtvagcaaewvrapgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyr
    lapehpfpaavedgvaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpas
    aipispwadmtctndsfktraeadpmvapgginkmaarylngadakhpyaspnfanlkgl
    ppllihvgrdevllddsikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrv
    gefmreqwaalaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h18A (A:)
    agpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqveqvtvagcaaewvra
    pgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyrlapehpfpaavedg
    vaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpasaipispwadmtctn
    dsfktraeadpmgginkmaarylngadakhpyaspnfanlkglppllihvgrdevlldds
    ikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrvgefmreqwaa